General Information

  • ID:  hor006209
  • Uniprot ID:  P41520
  • Protein name:  Cholecystokinin-25
  • Gene name:  CCK
  • Organism:  Bos taurus (Bovine)
  • Family:  Gastrin/cholecystokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0001764 neuron migration; GO:0007165 signal transduction; GO:0007409 axonogenesis; GO:0007586 digestion; GO:0032094 response to food; GO:0042755 eating behavior
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030424 axon

Sequence Information

  • Sequence:  VIKNLQSLDPSHRISDRDYMGWMDF
  • Length:  25
  • Propeptide:  MNRGVCLCLLMAVLAAGALAQPMPHADPTGPRAQQAEEAPRRQLRAVPRVDDEPRAQLGALLARYIQQARKAPSGRMSVIKNLQSLDPSHRISDRDYMGWMDFGRRSAEEFEYTS
  • Signal peptide:  MNRGVCLCLLMAVLAAGALA
  • Modification:  T19 Sulfotyrosine;T25 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  CCKBR, CCKAR
  • Target Unid:  P79266, A6QLH2
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P41520-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006209_AF2.pdbhor006209_ESM.pdb

Physical Information

Mass: 345269 Formula: C133H203N37O40S2
Absent amino acids: ACET Common amino acids: D
pI: 5.54 Basic residues: 4
Polar residues: 6 Hydrophobic residues: 7
Hydrophobicity: -65.2 Boman Index: -6278
Half-Life: 100 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 74
Instability Index: 7047.6 Extinction Coefficient cystines: 6990
Absorbance 280nm: 291.25

Literature

  • PubMed ID:  2217909
  • Title:  Purification of bovine cholecystokinin-58 and sequencing of its N-terminus.
  • PubMed ID:  4011954
  • Title:  Characterization of two novel forms of cholecystokinin isolated from bovine upper intestine.